PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00931.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 242aa    MW: 26472.7 Da    PI: 5.1697
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00931.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB131.52.8e-4161152293
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       ++ d+++Pian++ri++++lP++ak+++dake +qecvsefisf+t+ea+ +c+r+ r t++++d+l a+a+lGf+dy+e+l+v+l+++r  
  Migut.K00931.1.p  61 KDADEYMPIANITRILRRILPTHAKVADDAKEAIQECVSEFISFITAEANRRCRRDYRTTVTPEDVLAAMASLGFDDYLESLTVFLNNHRTQ 152
                       689*************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-4054162IPR009072Histone-fold
SuperFamilySSF471132.64E-3264164IPR009072Histone-fold
PfamPF008083.3E-2067130IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-1294112No hitNo description
PRINTSPR006152.9E-12113131No hitNo description
PRINTSPR006152.9E-12132150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEKGGSSNIE YKYTRGARTS VIREGGAARA AATATNAANI AGAPLNLVAE EVNQEQQGFK  60
KDADEYMPIA NITRILRRIL PTHAKVADDA KEAIQECVSE FISFITAEAN RRCRRDYRTT  120
VTPEDVLAAM ASLGFDDYLE SLTVFLNNHR TQQDPERGSR NQISQFVRRD DGVGVGFLHH  180
QQPQGAPTVW PPPPPPPLAA PTMGYYVPLP PPVAMEDEEE FGGLPKVTNK FGGGKEFDPF  240
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-3261150291Transcription factor HapC (Eurofung)
4g92_B4e-3261150291Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838634.11e-139PREDICTED: uncharacterized protein LOC105959133
TrEMBLA0A022QBY01e-133A0A022QBY0_ERYGU; Uncharacterized protein
STRINGscaffold_102469.11e-41(Arabidopsis lyrata)
STRINGscaffold_102467.11e-41(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-42NF-YB family protein